Product - Abyntek Biopharma

Protein

Canine coronavirus Nucleoprotein Protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1477334
Name:	Canine coronavirus Nucleoprotein Protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	(Nucleocapsid protein)(NC)(Protein N)
Unit:	20 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Canine coronavirus (strain BGF10) (CCoV) (Canine enteric coronavirus)
Aa sequence :	MASQGQRVSWGDESTKRRGRSNSRGRKNNDIPLSFFNPVTLKQGSKFWDLCPRDFVPLKIGNKDQQIGYWNRQIRYRMVKGQRKDLPERWFFYYLGTGPHADAKFKQKLDGVVWVAKEGAMTKPTTLGTRGTNNESKALKFDVKVPSEFQLEVNQSRDNSRSRSQSRSQSRTRAQSRGRQQSNNKKDDSVEQAVLAALKKLGVDTEKQQQRARSKSKERSNSKTRDTTPKNENKHTWKRTAGKGDVTKFYGARSS
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 85% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-tagged
Molecular weight :	49.5 kDa
Uniprot number :	Q7T6S8