Product - Abyntek Biopharma

Protein

Feline coronavirus Non-structural protein 7a Protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1477540
Name:	Feline coronavirus Non-structural protein 7a Protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	(ns7a)(11 kDa protein)(Accessory protein 7a)
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Feline coronavirus (strain FIPV WSU-79/1146) (FCoV)
Aa sequence :	VPDSSLRVNCLQLLKPDCLDFNILHKVLAETR
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 85% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Molecular weight :	19.7 kDa
Uniprot number :	P19742