Product - Abyntek Biopharma

Protein

Bovine coronavirus Non-structural protein of 4.8 kDa Protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1478064
Name:	Bovine coronavirus Non-structural protein of 4.8 kDa Protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	(ns4.8)(4.8 kDa accessory protein)
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Bovine coronavirus (strain OK-0514) (BCoV) (BCV)
Aa sequence :	MPMATTIDGTDYTNIMPITVFTTVYLGVFIGIDTSTTGFTCFSRY
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 85% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-SUMO-tagged
Molecular weight :	17.9 kDa
Uniprot number :	P0C2R8