Product - Abyntek Biopharma

Protein

Human IP-10 (rHuIP-10/CXCL10)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1494959
Name:	Human IP-10 (rHuIP-10/CXCL10)
Category:	Protein
Subcategory:	Proteins
Unit:	1.0 mg
price :	Consultar
format :	Sterile Filtered White lyophilized (freeze-dried) powder.
Aa sequence :	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP
buffer :	Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
endotoxin :	Less than 1EU/mg of rHuIP-10/CXCL10 as determined by LAL method.
specificactivity :	Fully biologically active when compared to standard. Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 10.0-100.0 ng/ml, corresponding to a Specific Activity of ?1 x 104 IU/mg.
Molecular weight :	8.5 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.