Product - Abyntek Biopharma

Protein

Recombinant Canine coronavirus Nucleoprotein (N)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1785036
Name:	Recombinant Canine coronavirus Nucleoprotein (N)
Category:	Protein
Subcategory:	Proteins
Aditional Names:	Nucleocapsid protein;NC;Protein N
Unit:	20 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Canine coronavirus (strain Insavc-1) (CCoV) (Canine enteric coronavirus)
Aa sequence :	MASQGQRVSWGDESTKRRGRSNSRGRKNNDIPLSFFNPITLEQGSKFWDLCPRDFVPKGIGNKDQQIGYWNRQTRYRMVKGRRKNLPEKWFFYYLGTGPHADAKFKQKLDGVVWVARGDSMTKPTTLGTRGTNNESKALKFDVKVPSEFHLEVNQLRDNSRSRSQSRSQSRNRSQSRGRQLSNNKKDDNVEQAVLAALKKLGVDTEKQQRSRSKSKERSSSKTRDTTPKNENKHTWKRTAGKGDVTKFYGARSSS
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 85% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Molecular weight :	50.9 kDa
Uniprot number :	P36298