Product - Abyntek Biopharma

Protein

Recombinant Monkeypox virus Cu-Zn superoxide dismutase-like protein (A46R)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1785148
Name:	Recombinant Monkeypox virus Cu-Zn superoxide dismutase-like protein (A46R)
Category:	Protein
Subcategory:	Proteins
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Monkeypox virus (strain Zaire-96-I-16) (MPX)
Aa sequence :	MAVCIIDHDNIRGVIYVEQVHGKDKVLGSVIGLKSGTYSLIIHRYGDISRGCDSIGSPEIFIGNIFVNRYGVAYVYLDTDVNISTIIGKALSISKNDQRLACGVIGISYINEKIIHFLTINENGV
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-SUMO-tagged
Molecular weight :	26.6 kDa
Uniprot number :	Q8V4T3