Product - Abyntek Biopharma

Protein

Recombinant Human Acetyl-CoA carboxylase 1 (ACACA), partial

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1785399
Name:	Recombinant Human Acetyl-CoA carboxylase 1 (ACACA), partial
Category:	Protein
Subcategory:	Proteins
Aditional Names:	(ACC1)(Acetyl-Coenzyme A carboxylase alpha)(ACC-alpha)
Unit:	100 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	SMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQELYEKGYVKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPN
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	C-terminal 6xHis-tagged
Molecular weight :	67.1 kDa
Uniprot number :	Q13085