Product - Abyntek Biopharma

Protein

Recombinant Rabbit T cell immunoreceptor with Ig and ITIM domains (TIGIT), partial

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb1881840
Name:	Recombinant Rabbit T cell immunoreceptor with Ig and ITIM domains (TIGIT), partial
Category:	Protein
Subcategory:	Proteins
Unit:	20 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Oryctolagus cuniculus (Rabbit)
Aa sequence :	APLLASGTMASMIVTTGNISAEEGGSAILQCHLSSTTTEVTQVNWEQQDRLLAVRHVDLGWHISPAFKERVVPGPSLSLTLLALTVNDTGEYFCTYHTYPDGIYKGRIFLEVRGSSVAEHSIGFQIP
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
purity :	Greater than 90% as determined by SDS-PAGE.
specificactivity :	Not Test
tag :	C-terminal hFc-tagged
Molecular weight :	42.7 kDa
Uniprot number :	G1SLC1