Product - Abyntek Biopharma

Protein

Human NRG1 protein (Active)

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb359178
Name:	Human NRG1 protein (Active)
Category:	Protein
Subcategory:	Proteins
Aditional Names:	Pro-NRG1, ARIA, Breast cancer cell differentiation factor p45, Glial growth factor, Heregulin
Unit:	10 ug
price :	Consultar
format :	Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
buffer :	Lyophilized from a 0.2 ?m filtered 1 × PBS, pH 7.4, with 5 % trehalose
Immunogen sequence :	122-186aa
purity :	> 97% as determined by SDS-PAGE and HPLC.
endotoxin :	Less than 1.0 EU/µg as determined by LAL method.
specificactivity :	Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 0.5 ng/ml, corresponding to a specific activity of ? 2.0 × 106 IU/mg.
tag :	Tag-Free
Molecular weight :	7.5 kDa
Uniprot number :	Q02297