Product - Abyntek Biopharma

Protein

Bacterial HRP1 protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb418912
Name:	Bacterial HRP1 protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	hrp1, Rv2626cHypoxic response protein 1, HRP1
Unit:	20 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Aa sequence :	MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	1-143aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Molecular weight :	35.5 kDa
Uniprot number :	P9WJA3