Product - Abyntek Biopharma

Protein

Human HER2 protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb604076
Name:	Human HER2 protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	Metastatic lymph node gene 19 protein , MLN 19Proto-oncogene NeuProto-oncogene c-ErbB-2Tyrosine kinase-type cell surface receptor HER2p185erbB2, , CD340
Unit:	1 mg
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Homo sapiens (Human)
Aa sequence :	VLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEIT
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	153-598aa
purity :	Greater than 90% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 6xHis-tagged
Molecular weight :	53.1 kDa
Uniprot number :	P04626