Product - Abyntek Biopharma

Protein

Primate FASLG protein

DESCRIPCIÓN

Supplier:	Biorbyt
Reference:	orb604082
Name:	Primate FASLG protein
Category:	Protein
Subcategory:	Proteins
Aditional Names:	CD95 ligand (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD_antigen, CD178) (CD95L) (FASL) (TNFSF6)
Unit:	100 ug
price :	Consultar
format :	Liquid or Lyophilized powder
note :	Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Aa sequence :	QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWAHSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
buffer :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Immunogen sequence :	102-280aa
purity :	Greater than 85% as determined by SDS-PAGE.
endotoxin :	Not test.
tag :	N-terminal 10xHis-tagged
Molecular weight :	26.5 kDa
Uniprot number :	P63308